DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and slc35b1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_989418.1 Gene:slc35b1 / 395058 XenbaseID:XB-GENE-972777 Length:342 Species:Xenopus tropicalis


Alignment Length:324 Identity:96/324 - (29%)
Similarity:144/324 - (44%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLSC-AGVFFLYILYGYLQELIFT---VEGFK--PYGWFLTLVQFGYYIGFGLVERRLEGYRISG 121
            ||.| .|||..|..||.|||.|..   .||.|  .:.:.|:|| |...|...|..:.|..:..||
 Frog    33 LLVCFLGVFVCYFYYGILQETITRGTYGEGEKQEKFRFALSLV-FVQCIVNALFAKLLIQFFDSG 96

  Fly   122 GS----FWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSIL 182
            .:    .|            .|...:...||.|..|||:|.::||||||:.|.||.|||::..:.
 Frog    97 KTDRTQSW------------LYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVT 149

  Fly   183 IQGKRYGLLDFAAATCMCIGLAWFTL-------ADSQMTPNFNLLGVAMISGALLCDAAIGNVQE 240
            :..|:|.|..:.....:.:|:|.|..       ...:.|..:   |..::..:|..|...|..|:
 Frog   150 LLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGY---GELLLLLSLTLDGLTGVSQD 211

  Fly   241 KAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQ 305
            .....|:..|:.::.|......::|...::.||..:...:|...:|...:.. .||||:..||..
 Frog   212 HMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNI-MLFSLTSALGQT 275

  Fly   306 FVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVV-LGIYLN-VYSKRNK 367
            |:...|...|....:.:||.||..||..|.:|||.|.: ...|.|.|:| ||:.|: .|.|.:|
 Frog   276 FIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPIS-SIQWVGTILVFLGLGLDATYGKGSK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 94/319 (29%)
EamA 219..362 CDD:279264 40/144 (28%)
slc35b1NP_989418.1 UAA 32..329 CDD:285625 92/313 (29%)
EamA <225..329 CDD:304911 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440867at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.