DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and CG14971

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_647817.2 Gene:CG14971 / 38429 FlyBaseID:FBgn0035449 Length:469 Species:Drosophila melanogaster


Alignment Length:400 Identity:71/400 - (17%)
Similarity:137/400 - (34%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GESAGNSPPSQRKSSTSESPPELRILCFDLTYYNRTTQFLLSCAGVFFLYILYGYLQELIFTVEG 88
            |:......|...:::|             |...|...|..:....:.|||:... :....:..:.
  Fly    57 GKCGSGEAPCTNETAT-------------LAQENMMMQMAVGTLAIIFLYLALS-ISLTFYQTDI 107

  Fly    89 FKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSF-----WNIEPEPRCIPMRTYLILAALTLG 148
            .:...:.|.:|.:...:.|.|.......||:..|..     |.       :.:|........:..
  Fly   108 NRQMPFPLAIVTYHLVVKFLLAAAARRIYRMRVGRSRVQLDWR-------LALRKMAPTGVASAI 165

  Fly   149 TMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSIL--IQGKRYGLLDFAAATCMCIGLAWFTLADS 211
            .:|.||..|..:......:.|...::.:|:.:|.  ::.|.:.|:....  .:..||..||...:
  Fly   166 DIGFSNWGLALVPISLYTMTKSSTIVFILLFAIAFGLEKKSWYLVSIVG--LIGTGLLMFTYKST 228

  Fly   212 QMTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKA---PSSEVVFYSYGLGFVYLFVIMLVTG 273
                :||.||...|..|.|......:..:..|::.|.   ...::::|..  .::...::.||.|
  Fly   229 ----DFNALGFFFILFASLSSGLRWSFAQFIMQKSKLGLHNPIDMIYYMQ--PWMIASLVPLVIG 287

  Fly   274 NFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALVR-SSGAPIA---------ATVTTARKA 328
            ...:|....:|            .|..:...:...|:.| |:||.:|         ....|:...
  Fly   288 IEGAGLIAVIE------------DLHNHTSNEITWAIARISAGALLAFLMEFSEFLVLCKTSSLT 340

  Fly   329 VTIAFSF---------VLFSKPFTLQYLWSGLIVVL-GIYLNVYSKRNKLTLADVRQRIKQFGAK 383
            ::||..|         |...|.......:.|||:.| ||..::..|.:.:.....:|.::....:
  Fly   341 LSIAGIFKDICQLALAVTIRKDHLSVINYIGLIICLAGIVCHLLHKYSNMKEMQRQQELQLDNDQ 405

  Fly   384 VARSPSR-KF 392
            ...||.. ||
  Fly   406 EESSPGEYKF 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 60/332 (18%)
EamA 219..362 CDD:279264 32/165 (19%)
CG14971NP_647817.2 TPT 86..382 CDD:281186 59/323 (18%)
PMT_2 111..325 CDD:304453 44/240 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.