DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and slc35a5

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_005167880.1 Gene:slc35a5 / 368418 ZFINID:ZDB-GENE-030616-55 Length:463 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:80/185 - (43%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LADSQMTPNFNLLGVAMISGALLC-DAAIGNV-QEKAMREFKAPSSEVVFYS---YGLGFVYLFV 267
            |.|||:....|..|:..:...|.| .:|:.|: .||.::|.:.....:...:   |..|.|:..:
Zfish   255 LWDSQLIHKLNSFGLGYVLLLLQCFISALANIYNEKILKEGEQLVESIFIQNSKLYLFGLVFNSL 319

  Fly   268 IMLVTGNFFSGFAFC---LEHPVETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAV 329
            .:|:..::.:....|   ..|.|.:...||:.:..| |.:.|:|....:....:...:||   .|
Zfish   320 TLLLHADYRNLTLHCGILYGHNVFSVALGFVTAALG-LSVAFILKFRDNMFHVLTGQITT---VV 380

  Fly   330 TIAFSFVLFSKPFTLQYLWSGLIVVLGIYLNVYSKRNKLTLADVRQRIKQFGAKV 384
            ..|.||.||....::.:.....:|:|.|::...||......|..::|::....:|
Zfish   381 VTALSFFLFDFQPSMDFFMQAPVVLLSIFIYHSSKMKDPEYALQQERLRVINGEV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 37/163 (23%)
EamA 219..362 CDD:279264 32/150 (21%)
slc35a5XP_005167880.1 Nuc_sug_transp 72..411 CDD:282054 37/159 (23%)
EamA 138..411 CDD:304911 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.