DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35B2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_835361.1 Gene:SLC35B2 / 347734 HGNCID:16872 Length:432 Species:Homo sapiens


Alignment Length:395 Identity:96/395 - (24%)
Similarity:164/395 - (41%) Gaps:77/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GNSP------PSQRKSSTSESPPELRILCFDLTYYNRTTQFLLSCA-GVFFLYILYGYLQELIFT 85
            ||.|      |...::..:|:.|..:.|            .||.|| |:...|:.:|.|||.:.|
Human    83 GNEPKASDEVPLAPRTEAAETTPMWQAL------------KLLFCATGLQVSYLTWGVLQERVMT 135

  Fly    86 VEGFKPYG-------------WFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMR 137
                :.||             .||.|:            .|:....::|.|....:......||.
Human   136 ----RSYGATATSPGERFTDSQFLVLM------------NRVLALIVAGLSCVLCKQPRHGAPMY 184

  Fly   138 TYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIG 202
            .|...:...:.:......:|.::::||||:.|..|:|||::...|:..:.|...::..||.:.||
Human   185 RYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIG 249

  Fly   203 LAWFTLA---DSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFV- 263
            ::.|.|:   :.:.:|...|.|:.:::|.:..|:...|.|: |:..:|..|.:::|   |:.|. 
Human   250 VSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQD-ALFAYKMSSVQMMF---GVNFFS 310

  Fly   264 YLFVI--MLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTAR 326
            .||.:  :|..|....|..|...|. |...:..|.|:....|..|:...:...||.:...:.|.|
Human   311 CLFTVGSLLEQGALLEGTRFMGRHS-EFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLR 374

  Fly   327 KAVTIAFSFVLFSKPFTLQYLWSGL---IVVLGIYLNVYSKRNKLTLADVRQRIKQFGAKV--AR 386
            :|..|..|.:|:....|:.   .||   :|...:.|.||:          |.|:||.|.|.  ..
Human   375 QAFAILLSCLLYGHTVTVV---GGLGVAVVFAALLLRVYA----------RGRLKQRGKKAVPVE 426

  Fly   387 SPSRK 391
            ||.:|
Human   427 SPVQK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 80/325 (25%)
EamA 219..362 CDD:279264 37/148 (25%)
SLC35B2NP_835361.1 UAA 111..412 CDD:312076 80/334 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.