DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and senju

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_608902.1 Gene:senju / 33734 FlyBaseID:FBgn0031676 Length:388 Species:Drosophila melanogaster


Alignment Length:369 Identity:74/369 - (20%)
Similarity:120/369 - (32%) Gaps:127/369 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FLYILYGYLQELIFTVEGFKPYGWFLTLVQFG---YYIGFGLVERRLEGYRISGGSFWNIEPEPR 132
            |||.||..|.              |:.|..|.   ||:   |::.|:.   ::|..|..|  ..:
  Fly    93 FLYCLYNNLA--------------FVNLATFDPTTYYL---LLQLRVV---VTGILFQII--FKK 135

  Fly   133 CIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSI-----------LIQ-- 184
            .:..|.::.|..||||                      |.:..|..||.           .||  
  Fly   136 YLSQRQWISLILLTLG----------------------CMMKQVDFGSFYSDANDDSESAAIQQQ 178

  Fly   185 ---------------GKRYGLLDF--------AAATCMCIGLAW--FTLADSQMTPNFNLLGVAM 224
                           ||.....||        |...|.|:...:  :.|.|.....|..:..|.|
  Fly   179 LQSHNKTTSAETHAHGKNMSGFDFSLSAVFILAQTICSCLAGVYNEYLLKDKGADVNIFVQNVFM 243

  Fly   225 ISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVET 289
            ...:::|:|.|..::.:.:..| :|.:        ||.:..|.::::..|               
  Fly   244 YLDSIVCNAVILLLRGELLDAF-SPQN--------LGSIMRFSVLIIIVN--------------- 284

  Fly   290 FGYGFLFSLSGYLGI--QFVLALVRSSGAPIAATVTTARKAV-TIAFSFVLFSKPFTLQYLWSGL 351
                     :..:||  .|.|..:.|    |..|..:|.:.: |....:.|||.|..:....:..
  Fly   285 ---------NAAIGIVTSFFLKYMNS----ILKTFASALELLFTAVLCYFLFSIPIYMNTALAIA 336

  Fly   352 IVVLGIYLNVYSKRNKLTLADVRQRIKQFGAKVARSPSRKFLIE 395
            :|...|||  |::...:.|..||.......|....:..||.:.|
  Fly   337 VVSYAIYL--YTQSPVVNLGKVRPLSNLSDATTKSTDKRKLIDE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 67/336 (20%)
EamA 219..362 CDD:279264 28/145 (19%)
senjuNP_608902.1 Nuc_sug_transp 44..346 CDD:282054 66/335 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.