DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35a1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006238058.1 Gene:Slc35a1 / 313139 RGDID:1311359 Length:336 Species:Rattus norvegicus


Alignment Length:326 Identity:68/326 - (20%)
Similarity:111/326 - (34%) Gaps:95/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLG-- 158
            :|||...|.|.........||...|..:.        ||   |.:|...:::|.:.....|||  
  Rat    20 MTLVAAAYTIALRYTRTTAEGLYFSTTAV--------CI---TEVIKLLISVGLLAKETGSLGRF 73

  Fly   159 -------YLNYPTQVIFKCCKL-IPVLV---------------------------------GSIL 182
                   .|..|.:::    || :|.||                                 .::|
  Rat    74 KASLSENVLGSPKELL----KLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVL 134

  Fly   183 IQGKRYGLLDFAAATCMCIGLAWFTLADSQMT-------PNFNLLGVAMISGALLCDAAIGNVQE 240
            :..:....|.:.:...:|.|:.......:|.|       |   |||...|:.|:||....|...|
  Rat   135 MLNRSLSKLQWISVFMLCGGVTLVQWKPAQATKVVVAQNP---LLGFGAIAIAVLCSGFAGVYFE 196

  Fly   241 KAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQ 305
            |.::     ||:...:...:......:.:.:.|.:.|..|...|.       ||.:..:.|  :.
  Rat   197 KVLK-----SSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEK-------GFFYGYTYY--VW 247

  Fly   306 FVLALVRSSGAPIAATVT---------TARKAV---TIAFSFVLFSKPFTLQYLWSGLIVVLGIY 358
            ||:.|....|...:..|.         :|..|:   |:| |.:||....||.:....|:|.:.||
  Rat   248 FVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVA-SVILFGLQITLSFTLGALLVCVSIY 311

  Fly   359 L 359
            |
  Rat   312 L 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 68/326 (21%)
EamA 219..362 CDD:279264 38/153 (25%)
Slc35a1XP_006238058.1 Nuc_sug_transp 8..314 CDD:282054 68/326 (21%)
nst 90..313 CDD:129885 50/241 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.