DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Ugalt

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster


Alignment Length:265 Identity:55/265 - (20%)
Similarity:94/265 - (35%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CIPMRTYLI---LAALTLGTMGLSNSSLGY-LNYPTQVIFKCC------------KLIPVLVGSI 181
            |:|...|::   |..::...:..:...:.| |...|..:|...            .|:.:::|.:
  Fly   103 CVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIV 167

  Fly   182 LIQ-----GKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFN-LLGVAMISGALLCDAAIGNVQE 240
            |:|     |...|....|||..        |.|.|...|..| :||:....||.......|...|
  Fly   168 LVQLAQTEGPTSGSAGGAAAAA--------TAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFE 224

  Fly   241 KAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFC-LEHPVETFGYGFLFSLSGYLGI 304
            |.::     .:|:        .|::..:.|...:...|...| :......|..||   ..||...
  Fly   225 KILK-----GAEI--------SVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGF---FKGYDLF 273

  Fly   305 QFVLALVRSSGAPIAATV------------TTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLGI 357
            .:.|.|:::.|..|.|.|            |:....::...|..:|....|||:.:...:|:..|
  Fly   274 VWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASI 338

  Fly   358 YLNVY 362
            :|..|
  Fly   339 FLYGY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 55/265 (21%)
EamA 219..362 CDD:279264 32/155 (21%)
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 54/262 (21%)
EamA 101..341 CDD:304911 53/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.