DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35c2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001101273.1 Gene:Slc35c2 / 311637 RGDID:1311250 Length:364 Species:Rattus norvegicus


Alignment Length:355 Identity:76/355 - (21%)
Similarity:127/355 - (35%) Gaps:103/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CFD--LTYYNR--TTQFLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLV 110
            ||.  :|:||:  |..|                            .:..|:|::.......|..:
  Rat    26 CFSIGITFYNKWLTKSF----------------------------HFPLFMTMLHLAVIFLFSAL 62

  Fly   111 ERRLEGYRISGGSFWNIEPEPRCIPMRTYLIL---------AALTLGT---MGLSNSSLGYLNYP 163
            .|.|                .:|...|..::|         |...|.|   :||||.|..|:...
  Rat    63 SRAL----------------VQCSSHRARVVLSWTDYLRRVAPTALATALDVGLSNWSFLYITVS 111

  Fly   164 TQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCI-----GLAWFTLADSQMTPNFNLLGVA 223
            ...:.|...::.:|:.|::     :.|.:..||..:.:     ||..||...:|    ||:.|.|
  Rat   112 LYTMTKSSAVLFILIFSLI-----FKLEELRAALVLVVLLIAGGLFMFTYKSTQ----FNVEGFA 167

  Fly   224 MISGALLCDAAIGNVQ--------EKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFA 280
            ::.||    :.||.::        :||....:.| .:.:|:...|.|:.||.:..|    |.|..
  Rat   168 LVLGA----SFIGGIRWTLTQMLLQKADLGLQNP-IDTMFHLQPLMFLGLFPLFAV----FEGLH 223

  Fly   281 FCLEHPVETF-GYGFLFSLSGYL--------GIQFVLALVRSSGAPIAATVTTARKAV-TIAFSF 335
            ......:..| ..|.|..:.|.|        |:.|...|:.|..:.:..::....|.| |:..:.
  Rat   224 LSTSEKIFRFQDPGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAA 288

  Fly   336 VLFSKPFTLQYLWSGLIVVL-GIYLNVYSK 364
            .|.....:| ..|.|..:.| ||.|:|..|
  Rat   289 HLLGDQISL-LNWLGFALCLSGISLHVALK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 69/338 (20%)
EamA 219..362 CDD:279264 37/161 (23%)
Slc35c2NP_001101273.1 TPT 16..313 CDD:281186 73/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.