DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35f2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001382663.1 Gene:Slc35f2 / 300713 RGDID:1311242 Length:375 Species:Rattus norvegicus


Alignment Length:328 Identity:73/328 - (22%)
Similarity:119/328 - (36%) Gaps:87/328 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KPYGW-FLTLVQFGYYI-----GFGLVERRL-EGYRISG---GSFWNIEPEPRCIPMRTYLILAA 144
            |.:.| .|..:..|..:     |..:..:.| |.||::.   .||.|.     |:....|.::.|
  Rat    33 KLFTWDILKTIALGQMLSLCICGTAITSQYLAEKYRVNTPMLQSFINY-----CLLFLVYTVMLA 92

  Fly   145 LTLGT----------------MGLSNSSLGYL-----NYP--TQVIFKCCKLIPVLVG-SILIQG 185
            ...|:                :||::....||     .|.  |.|....|..||||:. |..|..
  Rat    93 FQSGSDNLLEILRRKWWKYTLLGLADVEANYLIVRAYQYTTLTSVQLLDCFGIPVLMALSWFILR 157

  Fly   186 KRYGLLDFAAATCMCIGLAWFTLADSQMTPNFN------------LLGVAMISGALLCDAAIGNV 238
            .||.::.|.|.....:|:.....||.......|            |||.::.:.:.:|:..|  |
  Rat   158 ARYKVIHFIAVFVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAVSNVCEEYI--V 220

  Fly   239 QEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEH--PVETFGYGFLFSLSGY 301
            ::.:.:||             ||.|.||      |...||....:..  .:....:.:..:|   
  Rat   221 KKLSRQEF-------------LGMVGLF------GTIISGIQLLIVEYKDIARIQWDWKIAL--- 263

  Fly   302 LGIQFVLAL-VRSSGAPIAATVTTARK---AVTIAFSFVLFSKPFTLQYLWSGL------IVVLG 356
            |.:.|.|.: ...|..|:...||:|..   .:..|..:.||...|..:|.:|||      ::::|
  Rat   264 LFVAFALCMFCLYSFMPLVMKVTSATSVNLGILTADLYSLFFGLFLFEYKFSGLYILSFTVIMVG 328

  Fly   357 IYL 359
            ..|
  Rat   329 FIL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 73/328 (22%)
EamA 219..362 CDD:279264 35/153 (23%)
Slc35f2NP_001382663.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.