DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35g1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001178564.1 Gene:Slc35g1 / 294072 RGDID:1595908 Length:367 Species:Rattus norvegicus


Alignment Length:391 Identity:73/391 - (18%)
Similarity:118/391 - (30%) Gaps:128/391 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ITINGGESAGNSPPSQRKSSTSESPPELRILCFDLTYYNRTTQFLLSCAGVFFLYILYGYLQELI 83
            :...|....|...|.:..:..|...||.:          :|.    .|.|   |.:.|..|...:
  Rat    37 VEAEGAPGRGRCWPCRAWACGSRGEPEAK----------KTA----PCPG---LGLFYTVLSAFL 84

  Fly    84 FTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEG-YRISGGSFWNIEPEPRCIPMRTYLI------ 141
            |:|                    ..|:.::::| :.:...:|       ||:.....:|      
  Rat    85 FSV--------------------VSLLVKKVQGVHAVEISAF-------RCVVQMLVIIPCLIYR 122

  Fly   142 -----------LAALTLGTMGLSNSSLGYLNYPT------QVIFKCCKLIPVLVGSILIQGKRYG 189
                       |.....|..|.|...|.|..:.|      .||...|.:...:...|.:: ::|.
  Rat   123 KTGFIGPKGQRLFLFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLK-EKYS 186

  Fly   190 LLDFAAATCMCIGLAWFTLADSQMTPNFNLLGVAM----------------------ISGALLCD 232
            |.|           |:|||        |.:.||.:                      |.|..   
  Rat   187 LWD-----------AFFTL--------FAIAGVILIVRPTFLFGSNTSGMRESYSEHIKGTF--- 229

  Fly   233 AAIGNVQEKAMR--EFKAPSSEV-----VFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETF 290
            ||||:....||.  ..:.....|     ::|...||.....|::.|.|.:  ...:|....:   
  Rat   230 AAIGHAVLAAMTLVILRKMGKSVDYFLSIWYYVILGLPETIVVLFVIGEW--SLPYCGRDRL--- 289

  Fly   291 GYGFLFSLSGYLGIQ-FVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVV 354
             :..|..|.| ||.| |:...::...|.:.|.:.|........|....|....|...:...|.||
  Rat   290 -FLILIGLVG-LGAQIFITKALQIEKAGLVAIMKTMDVVFAFIFQIAFFDNVPTWWTVGGALCVV 352

  Fly   355 L 355
            :
  Rat   353 V 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 66/349 (19%)
EamA 219..362 CDD:279264 34/167 (20%)
Slc35g1NP_001178564.1 RhaT 73..362 CDD:223769 64/338 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.