DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and AT2G14695

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001323619.1 Gene:AT2G14695 / 28718270 AraportID:AT2G14695 Length:346 Species:Arabidopsis thaliana


Alignment Length:175 Identity:42/175 - (24%)
Similarity:60/175 - (34%) Gaps:48/175 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LILAALTLGTMGLSNSSLGY-LNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGL 203
            :||.|:..|...||..|.|| |.:...:   |......|:..|   ||..||..|        ||
plant   180 IILGAIIAGIRDLSFDSYGYGLVFTANI---CTATYLALISRI---GKSSGLNIF--------GL 230

  Fly   204 AWFTLADSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVI 268
            .|..             |:..|...||..:..|.::  ||..|.        :.|.:||..:..:
plant   231 MWCN-------------GIICIPFLLLWTSLKGELE--AMLSFP--------HLYSIGFQVVICL 272

  Fly   269 MLVTGNFFSGFAFCLEHPV---ETFGYGFLFSLSGYLGIQFVLAL 310
            ..:       .||.:.:.|   .|.......|:.|.|...|.:||
plant   273 SCM-------LAFMINYSVFLNTTLNSALTHSICGNLKDLFTIAL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 42/175 (24%)
EamA 219..362 CDD:279264 21/95 (22%)
AT2G14695NP_001323619.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10778
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.