DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35a4

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_671481.2 Gene:Slc35a4 / 257647 RGDID:628792 Length:324 Species:Rattus norvegicus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:74/196 - (37%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSVITINGGESAGNSPPSQRKSSTSESPPELRILCFDLTYYNRTTQFLLSC--AGVFFLYI-LYG 77
            |:.....|.:..||:.|..| |:....|..|.|....|..      .:|.|  :|:..:|. |..
  Rat   153 GACYASGGFQEPGNTLPGPR-SAAGARPMPLHITPLGLLL------LILYCLISGLSSVYTELIM 210

  Fly    78 YLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLIL 142
            ..|.|...::....| .|..::..|.|.|.|.....|||:  ||                 :.:|
  Rat   211 KRQRLPLALQNLFLY-TFGVILNLGLYAGSGPGPGFLEGF--SG-----------------WAVL 255

  Fly   143 AALTLGTMGLSNSSLGYLNYPTQV----IFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGL 203
            ..|.....||..|::  :.:.:.:    |..|..::..::.::|:|.:.......||   :.|||
  Rat   256 VVLNQAVNGLLMSAV--MKHGSSITRLFIVSCSLVVNAVLSAVLLQLQLTATFFLAA---LLIGL 315

  Fly   204 A 204
            |
  Rat   316 A 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 33/151 (22%)
EamA 219..362 CDD:279264
Slc35a4NP_671481.2 Nuc_sug_transp <83..320 CDD:398009 44/196 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.