DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35g1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_780716.1 Gene:Slc35g1 / 240660 MGIID:2444789 Length:368 Species:Mus musculus


Alignment Length:365 Identity:75/365 - (20%)
Similarity:119/365 - (32%) Gaps:118/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ITINGGESAGNSPPSQRKSSTSESPPEL--RILCFDL-TYYNRTTQFLLSCAGVFFLYILYGYLQ 80
            :...|....|...|....:..|...||.  :..|..| .:|...:.||.|.|.:|...:...:..
Mouse    37 VEAEGAPGRGRCWPCGAWACGSRGEPEAKKKAPCPGLGLFYTVLSAFLFSVASLFVKKVQGVHAV 101

  Fly    81 ELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAAL 145
            |    :..|:.....|.::....|        |..|:         |.|:.:    |.:|.|.  
Mouse   102 E----ISAFRCVVQMLVIIPCLIY--------RKTGF---------IGPKGQ----RLFLFLR-- 139

  Fly   146 TLGTMGLSNSSLGYLNYPT------QVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGLA 204
              |..|.|...|.|..:.|      .||...|.:...:...|.:: ::|.|.|           |
Mouse   140 --GVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLK-EKYSLWD-----------A 190

  Fly   205 WFTLADSQMTPNFNLLGVAM----------------------ISGALLCDAAIGNV--------- 238
            :|||        |.:.||.:                      |.|..   ||||:.         
Mouse   191 FFTL--------FAIAGVILIVRPPFIFGSDTSGMRESYSEHIKGTF---AAIGHAVLAAITLVI 244

  Fly   239 ---QEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLF-SLS 299
               ..|::..|.:     ::|...||.....:|:.|.|.:  ...:|        |...|| .|.
Mouse   245 LRKMGKSVDYFLS-----IWYYVILGLPEAIIILFVIGEW--SLPYC--------GLDRLFLILI 294

  Fly   300 GYLGIQ---FVLALVRSSGAPIAATVTTARKAVTIAFSFV 336
            |.||:.   |:...|:...|.:.|.:    |.:.|.|:|:
Mouse   295 GLLGLGGQIFITKAVQIEKAGLVAIM----KTMDIVFAFI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 66/320 (21%)
EamA 219..362 CDD:279264 32/156 (21%)
Slc35g1NP_780716.1 EamA 72..205 CDD:279264 38/181 (21%)
RhaT 73..362 CDD:223769 68/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.