DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35A3

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001258614.1 Gene:SLC35A3 / 23443 HGNCID:11023 Length:367 Species:Homo sapiens


Alignment Length:263 Identity:50/263 - (19%)
Similarity:102/263 - (38%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PMRTYLILAALTLGTMGLSNS----SLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAA 195
            ||.|  :..|:..|...|.|:    :|..|:..|..:....|::...:.|:.:..|:.|:..:.:
Human   123 PMET--LKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLS 185

  Fly   196 ATCMCIGLAWFTL-ADSQ-----MTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAP----S 250
            ...:..|:|:... :|||     ::.....:|:..:..|.......|...||.::|.|..    :
Human   186 LVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRN 250

  Fly   251 SEVVFYS--YGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALVRS 313
            .::.|:.  :||..||::...||:.|.|                     ..||..:.:::.::::
Human   251 IQLGFFGSIFGLMGVYIYDGELVSKNGF---------------------FQGYNRLTWIVVVLQA 294

  Fly   314 -SGAPIAATVTTA---RKAVTIAFSFVLFSKPFTLQYLW------------SGLIVVLGIYLNVY 362
             .|..|||.:..|   .|....:.|.:|.:   .:.|.|            ..::|:...:|..|
Human   295 LGGLVIAAVIKYADNILKGFATSLSIILST---LISYFWLQDFVPTSVFFLGAILVITATFLYGY 356

  Fly   363 SKR 365
            ..:
Human   357 DPK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 50/260 (19%)
EamA 219..362 CDD:279264 30/164 (18%)
SLC35A3NP_001258614.1 Nuc_sug_transp 46..355 CDD:282054 49/257 (19%)
nst 128..354 CDD:129885 45/249 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.