DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35a3

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006501488.1 Gene:Slc35a3 / 229782 MGIID:1917648 Length:338 Species:Mus musculus


Alignment Length:264 Identity:56/264 - (21%)
Similarity:101/264 - (38%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PMRTYLILAALTLGTMGLSNS----SLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAA 195
            ||.|  :..|:..|...|.|:    :|..|:..|..:....|::...:.|:.:.||:.|:..:.:
Mouse    93 PMET--LKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLS 155

  Fly   196 ATCMCIGLAWFTL-ADSQ------MTPNFNLLGVAMISGALLCDAAIGNVQEKAMREFKAP---- 249
            ...:..|:|:... :|||      ::.....:|:..:..|.......|...||.::|.|..    
Mouse   156 LVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIR 220

  Fly   250 SSEVVFYS--YGLGFVYLFVIMLVTGN-FFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALV 311
            :.::.|:.  :||..||::...||:.| ||.             ||..|        ...|:||.
Mouse   221 NIQLGFFGSIFGLMGVYVYDGELVSKNGFFQ-------------GYNQL--------TWIVVALQ 264

  Fly   312 RSSGAPIAATVTTA---RKAVTIAFSFVLFSKPFTLQYLW------------SGLIVVLGIYLNV 361
            ...|..|||.:..|   .|....:.|.:|.:   .:.|.|            ..::|:...:|..
Mouse   265 ALGGLVIAAVIKYADNILKGFATSLSIILST---IISYFWLQDFVPTSVFFLGAILVIAATFLYG 326

  Fly   362 YSKR 365
            |..:
Mouse   327 YDPK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 56/261 (21%)
EamA 219..362 CDD:279264 35/164 (21%)
Slc35a3XP_006501488.1 Nuc_sug_transp 13..326 CDD:282054 55/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.