DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and hut-1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_499652.1 Gene:hut-1 / 176690 WormBaseID:WBGene00013740 Length:340 Species:Caenorhabditis elegans


Alignment Length:334 Identity:83/334 - (24%)
Similarity:142/334 - (42%) Gaps:55/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FLLSCAGVFFLYILYGYLQELIF---------TVEGF---KPYGWFL----TLVQFGYYIGFGLV 110
            ||:...|:...|.::|..||.|.         ::|.|   :...:||    |:..|       |:
 Worm    24 FLICAGGILICYFVFGIQQERIVQGKYELPDESIEKFTFTQALVFFLCTANTIYAF-------LI 81

  Fly   111 ERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIP 175
            .::.|           |:.    :|.:.|...||..|..|..||.:|.||.|||||:.|.||.||
 Worm    82 RKKTE-----------IDN----VPTKMYAASAASYLLAMVASNQALQYLPYPTQVLAKSCKPIP 131

  Fly   176 VLVGSILIQGKRYGLLDFAAATCMCIGLAWFTLADSQ---MTPNFNLLGVAMISGALLCDAAIGN 237
            |::..:|...|.|....:.....:.:|:|.|...:.:   ...:|. .|..::..:|..|....:
 Worm   132 VMIFGVLFAHKSYHWRKYCYVLMIVVGVAMFLYKNKKGGAEDKDFG-FGELLLIFSLAMDGTTTS 195

  Fly   238 VQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGY- 301
            :|::..:.::...:.::||:.....:||...:||||..:|.|.|...||     |.| :.|:|. 
 Worm   196 IQDRIKKSYQRTGTSMMFYTNLYSSLYLSAGLLVTGELWSFFYFVQRHP-----YVF-WDLTGLA 254

  Fly   302 ----LGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLGIYLNVY 362
                ||...:...:........:.|||.||..||..|.:..:.|.:.:.:.:..:|...:..:|.
 Worm   255 IASCLGQWCIFKTIEEFSPLTCSIVTTTRKLFTIIISVLFMNHPLSGRQILATTVVFSALTADVV 319

  Fly   363 SKRNKLTLA 371
            .  .|:|.|
 Worm   320 D--GKMTAA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 80/325 (25%)
EamA 219..362 CDD:279264 33/147 (22%)
hut-1NP_499652.1 UAA 24..314 CDD:285625 79/318 (25%)
EamA 177..314 CDD:304911 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440867at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.