DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and ugtp-1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_498930.1 Gene:ugtp-1 / 176227 WormBaseID:WBGene00022721 Length:355 Species:Caenorhabditis elegans


Alignment Length:372 Identity:68/372 - (18%)
Similarity:110/372 - (29%) Gaps:141/372 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESAGNSPPSQRKSSTSESPPELRILCFDL-------TYYNRTTQFLLSCAGVFFLY-----ILYG 77
            |.|..||.|.|        |.....|:.:       |.|..|.::..|......:|     :|..
 Worm    26 EKADESPSSSR--------PSFVFKCYVIASMTFIWTAYTLTIKYTRSTVNPDMMYSSTSVVLCA 82

  Fly    78 YLQELIFTVEGFKPYGWFLTLVQFG----------YYIGFGLVERRLEGYRISGGSFWNIEPEPR 132
            .:.:|:.|      :..|.....|.          |||.                       .||
 Worm    83 EILKLVIT------FAMFYKECNFDSRQFSEQVSKYYIN-----------------------APR 118

  Fly   133 -----CIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYG--- 189
                 .:|...|.:  ...|..:||||...|.....||:     |::......:|..|:::.   
 Worm   119 ELAKMSVPSFAYAL--QNNLDFVGLSNLDAGLYQVTTQL-----KVVSTAFFMMLFLGRKFSTRR 176

  Fly   190 -----LLDFAA-------------------------------ATCMCIGLA--WF--TLADSQMT 214
                 ||.|..                               |||:..|.|  :|  .|.|...|
 Worm   177 WMAITLLMFGVAFVQMNNVSASEANTKRETAENYIVGLSAVLATCVTAGFAGVYFEKMLKDGGST 241

  Fly   215 P----NFNLLGVAMISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSY-----------GLGFVY 264
            |    |..:....:||.::.|           :.:|...|.:..|:.|           |:|.:|
 Worm   242 PFWIRNMQMYSCGVISASIAC-----------LTDFSRISDKGFFFGYTDKVWAVVILLGVGGLY 295

  Fly   265 LFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALV 311
            :.::|....|.:...|..:. .:.......|.....::|:.|||..:
 Worm   296 ISLVMRYLDNLYKSMASAVS-IILVVVLSMLIFPDIFIGMYFVLGTI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 57/329 (17%)
EamA 219..362 CDD:279264 18/104 (17%)
ugtp-1NP_498930.1 Nuc_sug_transp 37..351 CDD:282054 62/353 (18%)
nst 122..350 CDD:129885 45/239 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.