DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and B0041.5

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_491418.1 Gene:B0041.5 / 172075 WormBaseID:WBGene00015009 Length:429 Species:Caenorhabditis elegans


Alignment Length:238 Identity:55/238 - (23%)
Similarity:90/238 - (37%) Gaps:72/238 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 FAAATCMCIGLAWFTLADSQMTPNFNLLGVAMIS-------GALLCDA----------AIGNVQE 240
            |:|..|:.:.:              |:.||.::|       |||....          |.|:.:|
 Worm   224 FSAYKCLLVAI--------------NIAGVLIVSHYIPSFLGALFAQMSALAYAVYLFAFGHFEE 274

  Fly   241 KAMREFKAPSSEVVFYSYG-----LGFVYLFVIMLVTG----NFFSGFAFCLEHPV--ETFGYGF 294
            |                ||     |.|..:.||.||.|    |....|.....||:  .|.....
 Worm   275 K----------------YGKLDINLMFGAIGVIALVLGTPTLNLLDRFGVEPLHPLPNATQFSSI 323

  Fly   295 LFS-LSGYLGIQFVLALVRSSGAPIAATVTTA-RKAVTIAFSF----VLFSKPFTLQYLWSGLIV 353
            ||| |.|.:...::..|    .|.:..::||. ...|:|..||    |:.||..||..:.:.:.:
 Worm   324 LFSALIGTIVADYLWLL----AAGMCDSLTTCLSMTVSIPLSFLADTVIRSKAPTLAQVIASIPI 384

  Fly   354 VLGIYLNVYSKRNKLTLADVRQRIKQFGAKV-ARSPSRKFLIE 395
            ::......|: :|..|  .:|:.:.:...|| :.||..:.|::
 Worm   385 LVAFVGAAYA-QNPST--SIRKGLSKRVRKVESLSPDNEHLMD 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 47/204 (23%)
EamA 219..362 CDD:279264 42/176 (24%)
B0041.5NP_491418.1 RhaT <223..397 CDD:223769 47/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.