DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and SLC35A1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_006407.1 Gene:SLC35A1 / 10559 HGNCID:11021 Length:337 Species:Homo sapiens


Alignment Length:242 Identity:54/242 - (22%)
Similarity:92/242 - (38%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATC 198
            :|...|.:  ...:..:.|||..........|:...|..|.     ::|:..:....|.:.:...
Human    93 VPSLVYAV--QNNMAFLALSNLDAAVYQVTYQLKIPCTALC-----TVLMLNRTLSKLQWVSVFM 150

  Fly   199 MCIGLA---WFTLADSQMTPNFN-LLGVAMISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYG 259
            :|.|:.   |.....:::....| |||...|:.|:||....|...||.::     ||:...:...
Human   151 LCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLK-----SSDTSLWVRN 210

  Fly   260 LGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVT- 323
            :......:|:.:.|.:.|..|...|.       ||.:..:.|  :.||:.|....|...:..|. 
Human   211 IQMYLSGIIVTLAGVYLSDGAEIKEK-------GFFYGYTYY--VWFVIFLASVGGLYTSVVVKY 266

  Fly   324 --------TARKAV---TIAFSFVLFSKPFTLQYLWSGLIVVLGIYL 359
                    :|..|:   ||| |.:||....||.:....|:|.:.|||
Human   267 TDNIMKGFSAAAAIVLSTIA-SVMLFGLQITLTFALGTLLVCVSIYL 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 54/242 (22%)
EamA 219..362 CDD:279264 40/153 (26%)
SLC35A1NP_006407.1 Nuc_sug_transp 8..314 CDD:282054 54/242 (22%)