DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and Slc35a2

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_038955312.1 Gene:Slc35a2 / 100158233 RGDID:2293497 Length:423 Species:Rattus norvegicus


Alignment Length:317 Identity:65/317 - (20%)
Similarity:109/317 - (34%) Gaps:91/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VFFLY--ILYGYLQ-------ELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSF 124
            |.||:  :|..|:.       .||:|::....|.....|....:....|...:.|   .:||.  
  Rat    98 VLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQAHSGCCPKPL---ALSGS-- 157

  Fly   125 WNIEPEPRCIPMRTYLILAALT--LGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKR 187
            |:....|....::....|..||  |.::.:.|.||..|.:        ..|:.:..|..::|.::
  Rat   158 WDQPSVPSTCNLQVTYQLKILTTALFSVLMLNRSLSRLQW--------ASLLLLFTGVAIVQAQQ 214

  Fly   188 YG-----LLD------FAAATCMCI-----------------GLAWFTLADSQMTPNFNLLGVAM 224
            .|     .||      .||....|:                 |..|  |.:.|:    .|.|.|:
  Rat   215 AGGSGPRPLDQNPGVGLAAVVASCLSSGFAGVYFEKILKGSSGSVW--LRNLQL----GLFGTAL 273

  Fly   225 ISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSY-----------GLGFVYLFVIMLVTGNFFSG 278
                    ..:|    ....|..|.:|:..|:.|           ..|.:.:.|::....|...|
  Rat   274 --------GLVG----LWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKG 326

  Fly   279 FAFCLEHPVETFG----YGF----LFSLSG--YLGIQFVLALVRSSGAPIAATVTTA 325
            ||..|...:.|..    :||    ||:|..  .:|..::.:|.|.:...||:...:|
  Rat   327 FATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYSLPRGAVKAIASASASA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 65/317 (21%)
EamA 219..362 CDD:279264 28/128 (22%)
Slc35a2XP_038955312.1 Nuc_sug_transp 31..367 CDD:398009 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.