DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Papst2 and slc35g1

DIOPT Version :9

Sequence 1:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_001341822.1 Gene:slc35g1 / 100001920 ZFINID:ZDB-GENE-121214-166 Length:409 Species:Danio rerio


Alignment Length:168 Identity:38/168 - (22%)
Similarity:59/168 - (35%) Gaps:70/168 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 EKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLE-----HPVET---------- 289
            |..:::.|.||..      |||.:|    .|:...|||..|..::     |.::.          
Zfish    97 ENTVQKEKQPSCP------GLGLMY----SLLASVFFSIAALLVKKMEGMHAIQISAIRCFFQML 151

  Fly   290 --------FGYGFL--------FSLSGYLGIQFVLALVRS-SGAPIA-ATVTTARKAVTIAFSFV 336
                    :..|||        ..|.|:||...::.|..: ...|:| |||             :
Zfish   152 FVLPAMIYYKTGFLGPRGMRIYLFLRGFLGSNAMILLYYAVLQMPLADATV-------------I 203

  Fly   337 LFSKP-FTLQYLWSGLIVVLGIYLNVYSKRNKLTLADV 373
            :||.| ||....|        |:|     :.:.|:.||
Zfish   204 MFSNPVFTALLAW--------IFL-----KERCTIWDV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Papst2NP_648954.1 UAA 61..364 CDD:285625 35/157 (22%)
EamA 219..362 CDD:279264 35/155 (23%)
slc35g1XP_001341822.1 EamA 110..243 CDD:279264 34/149 (23%)
RhaT 111..400 CDD:223769 33/148 (22%)
EamA 263..398 CDD:279264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.