DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fit2 and Rdx

DIOPT Version :9

Sequence 1:NP_648947.1 Gene:Fit2 / 39907 FlyBaseID:FBgn0036688 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_038937380.1 Gene:Rdx / 315655 RGDID:1359472 Length:604 Species:Rattus norvegicus


Alignment Length:427 Identity:77/427 - (18%)
Similarity:153/427 - (35%) Gaps:129/427 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 WLDSSLSIMEQGIREYDTLCLRFKYFTFF--DLNPKCDQVRINQL-YEQAKWSVLNEELDCTEEE 340
            ||..:..:.:|.:::.:.|..:|: ..||  |::.:..|....:| :.|.|.::||:|:.|..|.
  Rat    58 WLKLNKKVTQQDVKKENPLQFKFR-AKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPET 121

  Fly   341 SLMFAALQFQV-----NHHVDHTPQGAAVDSGIETSSQENDNEDEIDSALKELQITLEG-----P 395
            :::.|:...|.     |..: |.|...|.|..:.            ...|::.::|.|.     .
  Rat   122 AVLLASYAVQAKYGDYNKEI-HKPGYLANDRLLP------------QRVLEQHKLTKEQWEERIQ 173

  Fly   396 DYGGDSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRD------------LHLHLFKNAEDS 448
            ::..:.|.:.|...:.:||:..:    .|..|...||..::            |.|:::   |..
  Rat   174 NWHEEHRGMLREDSMMEYLKIAQ----DLEMYGVNYFEIKNKKGTELWLGVDALGLNIY---EHD 231

  Fly   449 RRVAPA----------ISINLKGCEV------TPDVNLSQGKYAIRLEVSPD------GGHGINS 491
            .::.|.          ||.|.|...:      .||...    ||.||.::..      |.|    
  Rat   232 DKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVF----YAPRLRINKRILALCMGNH---- 288

  Fly   492 EVWVRCE--------------NEQQYAKWMAACRL--AAKGRSLADSS---YESEVDSILSLLQM 537
            |:::|..              .|:::.|.:...:|  ..|.|.:|:..   .|.|.:.::..|  
  Rat   289 ELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERL-- 351

  Fly   538 QRPAHGVHVNIDPRSVEAVDYLSPKIIRKLSNKAVQRILEAHANVRELNALDSKLKYIQAWRS-- 600
                         |.:|.....:.|.:.:.:.||::...|......|...||.:.:..:..:|  
  Rat   352 -------------RQIEEQTMKAQKELEEQTRKALELEQERQRAKEEAERLDRERRAAEEAKSAI 403

  Fly   601 -----------------LPDFGVSLFIIKFDGHRKEE 620
                             |.:|...:.:::....:|||
  Rat   404 AKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fit2NP_648947.1 B41 259..>351 CDD:214604 18/74 (24%)
FERM_M 310..>365 CDD:278785 15/60 (25%)
PH_fermitin 408..536 CDD:269943 32/180 (18%)
PH 408..515 CDD:278594 27/156 (17%)
FERM_M <557..609 CDD:278785 10/70 (14%)
FERM_C_fermitin 603..693 CDD:270026 4/18 (22%)
RdxXP_038937380.1 B41 7..206 CDD:214604 33/165 (20%)
FERM_C_ERM 200..296 CDD:270015 21/106 (20%)
ERM 347..583 CDD:395622 16/109 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.