DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fit2 and Frmd3

DIOPT Version :9

Sequence 1:NP_648947.1 Gene:Fit2 / 39907 FlyBaseID:FBgn0036688 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_766457.1 Gene:Frmd3 / 242506 MGIID:2442466 Length:595 Species:Mus musculus


Alignment Length:345 Identity:64/345 - (18%)
Similarity:117/345 - (33%) Gaps:90/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 SLVEKARLNV---------GWLDSSLSIMEQGIREYD--TLCLRFKYFTFFDLNPKCDQVRINQL 321
            ||:||....:         .||:.:.||.:| ::.:.  |:|.|.|::....|..|.:..|. .|
Mouse    66 SLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQ-MKSHPPYTMCFRVKFYPHEPLKIKEELTRY-LL 128

  Fly   322 YEQAKWSVLNEELDCTEEESLMFAALQFQV---NHHVDHTPQGAAVDSGIETSSQENDNEDEIDS 383
            |.|.|..:.:..|.|:..::....|...|.   :::.|..|:....:..|.....:.        
Mouse   129 YLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQK-------- 185

  Fly   384 ALKELQITLEGPDYGGDSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRDLHLHLFKNAEDS 448
             |:...:.:...:..|.|      |.::::...||.......|.        |.|     ..:||
Mouse   186 -LERKIMEIHNNELRGQS------PAIAEFNLLLKAHTLETYGV--------DPH-----PCKDS 230

  Fly   449 RRVAPAISINLKGCEVTPDVNLSQGKYAIRLEVSPDGGHGINSEVWVRCENEQQYAKWMAACRLA 513
            |.....:.....|..|      .||...|.|.                        ||...|:|.
Mouse   231 RGATAFLGFTAAGFVV------FQGNKRIHLR------------------------KWSDVCKLK 265

  Fly   514 AKGRSLADSSYESEVDSILSLLQMQRPAHGVHV---NID-------PRSVEAVDYLSPKIIRK-- 566
            .:|::......:.|.:::|: .....||...|:   .::       .:|.:.....|.||..|  
Mouse   266 FEGKTFYVIGSQKEKNAVLA-FHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGS 329

  Fly   567 ---LSNKAVQRILEAHANVR 583
               .|.|..:.::||.:.::
Mouse   330 RFRYSGKVAKEVVEASSKIQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fit2NP_648947.1 B41 259..>351 CDD:214604 23/93 (25%)
FERM_M 310..>365 CDD:278785 12/57 (21%)
PH_fermitin 408..536 CDD:269943 22/127 (17%)
PH 408..515 CDD:278594 19/106 (18%)
FERM_M <557..609 CDD:278785 8/32 (25%)
FERM_C_fermitin 603..693 CDD:270026
Frmd3NP_766457.1 B41 33..225 CDD:214604 35/183 (19%)
FERM_N 36..99 CDD:286467 9/33 (27%)
FERM_M 117..225 CDD:278785 22/131 (17%)
PH-like 206..309 CDD:302622 24/146 (16%)
FA 323..>357 CDD:285894 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.