DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and Phk-3

DIOPT Version :9

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286870.1 Gene:Phk-3 / 37997 FlyBaseID:FBgn0035089 Length:121 Species:Drosophila melanogaster


Alignment Length:129 Identity:53/129 - (41%)
Similarity:80/129 - (62%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VALMCTTCFQVEGLPHPPATSPSPMMERMVEQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGP 81
            :||:...|.   ||   .|.:|        |:.|.:|:|:|::||:|...|:|.||:|||...||
  Fly     5 LALVFCVCV---GL---AAAAP--------EKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGP 55

  Fly    82 CTPDAKMLKEILPDAIQTDCTKCTEKQRYGAEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQ 145
            ||.:.:.||.:||||:.:||:||||.||..::||..:|..|:..:|:.|...|||:|.||.|::
  Fly    56 CTAEGRELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGIYRAKHE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 42/90 (47%)
Phk-3NP_001286870.1 OS-D 24..115 CDD:281395 42/90 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CRZI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27156
OrthoDB 1 1.010 - - D116230at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.