DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and CG30172

DIOPT Version :9

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286811.1 Gene:CG30172 / 246496 FlyBaseID:FBgn0050172 Length:112 Species:Drosophila melanogaster


Alignment Length:81 Identity:24/81 - (29%)
Similarity:39/81 - (48%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEKQRYGAEKVTRHL 119
            |..:::::||.:.::...|.|:.|...|......||..||:.|...|..|:.:|...|:|:|..|
  Fly    30 DERNINKLLNNQVVVSRQIMCILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQKLTTFL 94

  Fly   120 IDNRPTDWERLEKIYD 135
            ....|..|..|.:.||
  Fly    95 QTRYPDVWAMLLRKYD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 24/81 (30%)
CG30172NP_001286811.1 OS-D 30..110 CDD:281395 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.