DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and AgaP_AGAP008054

DIOPT Version :9

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_317405.3 Gene:AgaP_AGAP008054 / 1277896 VectorBaseID:AGAP008054 Length:126 Species:Anopheles gambiae


Alignment Length:104 Identity:60/104 - (57%)
Similarity:70/104 - (67%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEKQRYG 111
            :..|..|:|.|||||||..:||..||.|||..||.||||...||.|||||::|||.||:|||:.|
Mosquito    18 QDKYTTKYDGVDLDEILKSDRLFNNYYKCLMDTGRCTPDGNELKRILPDALKTDCAKCSEKQKSG 82

  Fly   112 AEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQEMKSK 150
            .|||..:|||||...||.|:|.||||..|..||:|...|
Mosquito    83 TEKVINYLIDNRKDQWENLQKKYDPENIYVNKYREDAKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 55/90 (61%)
AgaP_AGAP008054XP_317405.3 OS-D 21..113 CDD:281395 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27156
OrthoDB 1 1.010 - - D116230at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.