DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and AgaP_AGAP008058

DIOPT Version :9

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_317401.4 Gene:AgaP_AGAP008058 / 1277892 VectorBaseID:AGAP008058 Length:191 Species:Anopheles gambiae


Alignment Length:104 Identity:37/104 - (35%)
Similarity:60/104 - (57%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ERMVEQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEK 107
            :.:....|..::||:|:|.||...||:.||:.||....||.|:.|.||.|||:|::|.|.:|:..
Mosquito    21 QEVARTLYSTRYDNLDIDTILASNRLVTNYVDCLLSRKPCPPEGKDLKRILPEALRTKCARCSPI 85

  Fly   108 QRYGAEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQE 146
            |:..|.|:...|..:.|..:..|.:.:||.|.|..:::|
Mosquito    86 QKENALKIITRLYYDYPDQYRALRERWDPSGEYHRRFEE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 35/90 (39%)
AgaP_AGAP008058XP_317401.4 OS-D 28..120 CDD:281395 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.