DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6652 and LCA5L

DIOPT Version :9

Sequence 1:NP_648946.3 Gene:CG6652 / 39905 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_011527760.1 Gene:LCA5L / 150082 HGNCID:1255 Length:719 Species:Homo sapiens


Alignment Length:537 Identity:113/537 - (21%)
Similarity:213/537 - (39%) Gaps:130/537 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MSSQNHSEIHQRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQSSALNKYEAHNAE 131
            |.:|....:..|::|||..:.|..:|:|||...::..:..||:.|:.|..|...|:.|||.....
Human   180 MIAQRRDAMAHRILSARLHKIKGLKNELADMHHKLEAILTENQFLKQLQLRHLKAIGKYENSQNN 244

  Fly   132 LPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQLNKDKNLDERQKL 196
            ||::::.|..|::..:...||.|...:.|..||::.:..:|...|..:...:|::||||.||::|
Human   245 LPQIMAKHQNEVKNLRQLLRKSQEKERTLSRKLRETDSQLLKTKDILQALQKLSEDKNLAEREEL 309

  Fly   197 QEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEVMLKLEKAKLEISGYRKLEE 261
            ..||..:..:::..|..::.:.::::|..:...:||..|.||                       
Human   310 THKLSIITTKMDANDKKIQSLEKQLRLNCRAFSRQLAIETRK----------------------- 351

  Fly   262 YTLGTDKVNPLSSGRRTKLSGVTDEPDKIDKLEKSMEMLDKAIEKNNQSEFTALTDVMESESFYD 326
                     .|::...||...|     ::..|::.::..|:.:|..|......|.::.::|   |
Human   352 ---------TLAAQTATKTLQV-----EVKHLQQKLKEKDRELEIKNIYSHRILKNLHDTE---D 399

  Fly   327 FEKDSAEDKSGPNTPPSQIERQVGGRGGKLILPPATNHAKMGQKANRSTLSQVLSAQGKISVSSG 391
            :.|.|       :|...|.:|:        |||..:...:..||::...|:           :.|
Human   400 YPKVS-------STKSVQADRK--------ILPFTSMRHQGTQKSDVPPLT-----------TKG 438

  Fly   392 KSAKSRIAVAVPKMESVQVSKRREPETVSRLASAETKPKQKPLEYEYEDDYEPAGEDGDDDAYGM 456
            |.|...|.   .|.:|.::: ...|..|::|      |||:..:.:|||                
Human   439 KKATGNID---HKEKSTEIN-HEIPHCVNKL------PKQEDSKRKYED---------------- 477

  Fly   457 MSKMCEGEEPQDNSEENANESSLLKYSAYMDNKSSEGDPLEESMEEYDGTDGQQ----------- 510
                ..|||..            |:....::|...:.|..|:..::......:|           
Human   478 ----LSGEEKH------------LEVQILLENTGRQKDKKEDQEKKNIFVKEEQELPPKIIEVIH 526

  Fly   511 -SQGSDDEDISVRAPRLKENMSSLRKQISNDF-KERESFLKTFCRQASNSNMRDDSASKKRNSIA 573
             .:.|:.||:.|| .:.|.:|.  |..:.:.. |....:.|...||..:.:..:.:.:......|
Human   527 PERESNQEDVLVR-EKFKRSMQ--RNGVDDTLGKGTAPYTKGPLRQRRHYSFTEATENLHHGLPA 588

  Fly   574 TGAAAS------SHMTG 584
            :|..|:      ||.||
Human   589 SGGPANAGNMRYSHSTG 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 45/174 (26%)
GBP_C <151..252 CDD:303769 25/100 (25%)
coiled coil 239..250 CDD:293879 0/10 (0%)
LCA5LXP_011527760.1 Lebercilin 195..374 CDD:292252 50/215 (23%)
BAR <206..>299 CDD:299863 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159371
Domainoid 1 1.000 95 1.000 Domainoid score I7420
eggNOG 1 0.900 - - E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004975
OrthoInspector 1 1.000 - - oto89145
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16650
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.