DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and Aplip1

DIOPT Version :10

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster


Alignment Length:72 Identity:21/72 - (29%)
Similarity:36/72 - (50%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1949 HSYESDEPDVLQLELGDVVNVSRKLPDGWYQGERIRDGAVGWFPGSYTEEL--NSAHVRARNLKQ 2011
            |.:.....|.::||:||.:.|.::..|.|.:|..:|.|..|.||.:|..:|  |......:.:|:
  Fly   280 HKFVPRHHDEIELEIGDAIYVQKEAEDLWCEGVNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKK 344

  Fly  2012 RHRLLTF 2018
            ...||.:
  Fly   345 ERYLLGY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1762 CDD:459876
PH_ephexin 1805..1931 CDD:269929
SH3_ephexin1_like 1944..1998 CDD:212727 16/48 (33%)
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 16/48 (33%)
PTB_JIP 343..490 CDD:269923 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.