DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and ARHGEF3

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_001122087.1 Gene:ARHGEF3 / 50650 HGNCID:683 Length:558 Species:Homo sapiens


Alignment Length:503 Identity:103/503 - (20%)
Similarity:193/503 - (38%) Gaps:148/503 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1482 SEPHSLFSN---EPLYQMYS---------AAKLESITRDLEAHGSSDGYEEIGLQAKAKPEPLVK 1534
            |||    ||   :||.::.|         |..|:..::.|:        ..|..:::::|: ::.
Human    64 SEP----SNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQ--------RSISFRSESRPD-ILA 115

  Fly  1535 PRPTALQLVEPKN-GPSRT------LWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLK 1592
            |||.:      :| .||.|      ||||..:|   |:...|||:|...|||.||:...|...::
Human   116 PRPWS------RNAAPSSTKRRDSKLWSETFDV---CVNQMLTSKEIKRQEAIFELSQGEEDLIE 171

  Fly  1593 SLNLLRRHFMNHNAFLDSSVLSAKDRKALF---SYIVPVHECSERLLTELEACWQDN-------I 1647
            .|.|.::.:  |:..|..|:::.::...:|   ..::|:|   |.||::|....:.:       .
Human   172 DLKLAKKAY--HDPMLKLSIMTEQELNQIFGTLDSLIPLH---EELLSQLRDVRKPDGSTEHVGP 231

  Fly  1648 MLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLH 1712
            :|:|...|:..        |.::|.:|......   |...|:....|..|:|...||....|:|.
Human   232 ILVGWLPCLSS--------YDSYCSNQVAAKAL---LDHKKQDHRVQDFLQRCLESPFSRKLDLW 285

  Fly  1713 SFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERI 1777
            :||.:|..|:.:.|||:..:. :.:|.:..:.:..:..:.::|.:|.:.|......|..:..||:
Human   286 NFLDIPRSRLVKYPLLLREIL-RHTPNDNPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERL 349

  Fly  1778 ARQLEFPSHVRALAIAPVGVPRAGAK------PRFLVKRGELTHLLWRGEDAKLTFGKRLTKISI 1836
            ....|                  |.|      .|.|...|||               |....:.:
Human   350 LYLEE------------------GQKDSLIDSSRVLCCHGEL---------------KNNRGVKL 381

  Fly  1837 YAFLFSDLLLLCK---RRGESCFSVFDYCPRSMLTLAAGDSLPQLPTKDL--------------- 1883
            :.|||.::|::.:   ...:.|:.::               ...:|.|||               
Human   382 HVFLFQEVLVITRAVTHNEQLCYQLY---------------RQPIPVKDLLLEDLQDGEVRLGGS 431

  Fly  1884 ------KDQAGKNLILMTLLENCDRKTVELVLSCPSVSDQQRWLQAMR 1925
                  .::..||...::.......:|..  |......::|:||..:|
Human   432 LRGAFSNNERIKNFFRVSFKNGSQSQTHS--LQANDTFNKQQWLNCIR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 40/191 (21%)
PH_ephexin 1805..1931 CDD:269929 23/145 (16%)
SH3_ephexin1_like 1944..1998 CDD:212727
ARHGEF3NP_001122087.1 RhoGEF 158..334 CDD:395496 41/192 (21%)
PH_RhoGEF3_XPLN 348..480 CDD:269976 27/180 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.