DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and si:dkey-172h23.2

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_957093.1 Gene:si:dkey-172h23.2 / 393772 ZFINID:ZDB-GENE-141212-258 Length:221 Species:Danio rerio


Alignment Length:170 Identity:37/170 - (21%)
Similarity:57/170 - (33%) Gaps:47/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1302 LSSLAPTRS-------TFYVEDPEGSLPALPLEP-----------------EIHGSGELDSG-FS 1341
            |.::.|..:       |.:...|:|.:.:|..||                 .:..:|.|:.. ..
Zfish    58 LQAVCPAHNCCESVLVTLFSTGPDGLVHSLATEPLVFVQDLAFDMAQFLVSAVGQTGILEEALLL 122

  Fly  1342 DKNCTPLPETPKFSTVARKAKKEAKANRRRTTIGLRPNDPPPPPPPMTGNKSPLDPEREL---DA 1403
            |::..||.|..|.......|.|....               ||...:.||.:.:||:..|   .|
Zfish   123 DEHQIPLQECEKLDLSLSLALKHLTL---------------PPGWSLIGNNTRMDPQETLLHFAA 172

  Fly  1404 EQTTSWYAECGVFKQATNGAVSPR---GDEPVTPTPS-GH 1439
            .:..|..|...:.:.....|:|.|   ||.||....| ||
Zfish   173 RRGLSKVARFLLKQPGAREALSLRNRQGDTPVLIAQSRGH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015
PH_ephexin 1805..1931 CDD:269929
SH3_ephexin1_like 1944..1998 CDD:212727
si:dkey-172h23.2NP_957093.1 ANK repeat 163..197 CDD:293786 7/33 (21%)
ANK <165..218 CDD:238125 14/48 (29%)
Ank_4 166..219 CDD:290365 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.