DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and RhoGEF4

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:154/389 - (39%) Gaps:92/389 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1470 TGNEAGLGDELSSEPHS--LFSNEPLYQ------MYSAAKLESITRDLEAHGSSDGYEEIGLQAK 1526
            |..:.|.|:.....|.:  .||.| |.|      :.:|.....:...|:::.||           
  Fly     3 TPRQKGYGNGFIHSPQTPLSFSRE-LRQVLQERNLLTAKSRRKVCSMLDSNNSS----------- 55

  Fly  1527 AKPEPLVKPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYL 1591
                |:..|.|.|.:                          .|..|.:::|    |||:||.|||
  Fly    56 ----PIGSPNPDAGK--------------------------RLGFRRQAIQ----EIISSEKSYL 86

  Fly  1592 KSLNLLRRHFMNHNAFLDSSVLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCI 1656
            :.|.||...|:  ....:.:::...:...||..|..:|..:...|.||||..::      ::...
  Fly    87 EQLELLMNFFV--RPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANMEN------VAHAF 143

  Fly  1657 YEIAERHFHVYVAFC-EHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQ 1720
            .::|. .|.:|..:. :::|.:......:.::.   .|::.||:.|:.|. ....|:|.:::|:|
  Fly   144 LKMAP-FFKLYSVYAFDYRGALFIIQDLISKNP---VFRKFLEQTESRPE-VQRKLNSLMIVPIQ 203

  Fly  1721 RITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEFPS 1785
            |:.|..||::.|....||.: .:|:       |:::.|.:....|:......|.:.|.:.|   .
  Fly   204 RVPRYKLLLEQVLLYTSPAD-ADYK-------LLKESVKEIEATASHINTCVEEQEITQYL---I 257

  Fly  1786 HVRALAIAPVGVPRAGAKPRFLVKRGELTHLLWRGEDAKLTFGKRLTKISIYAFLFSDLLLLCK 1849
            |::...:.  ..|......|.::|.|.|..:..:|           |:|..|..|.||:.:.||
  Fly   258 HLQNSLVN--RTPNIVKPSRRVIKEGVLQKITHKG-----------TEIKRYCVLMSDIFMYCK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 44/182 (24%)
PH_ephexin 1805..1931 CDD:269929 13/45 (29%)
SH3_ephexin1_like 1944..1998 CDD:212727
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/194 (24%)
PH-like 269..>311 CDD:302622 13/51 (25%)
PH 277..374 CDD:278594 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.