DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and Fgd3

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:XP_008769765.1 Gene:Fgd3 / 361223 RGDID:1311725 Length:733 Species:Rattus norvegicus


Alignment Length:627 Identity:120/627 - (19%)
Similarity:223/627 - (35%) Gaps:162/627 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1425 SPRGDEPVTP----TPSGHGGVSSWYAESGLYQTSGISVASSSGSSGVSTGNEAGLGDELSSEPH 1485
            ||.|.....|    .|.|..|.|:...:|.|.:.|| ::...:..||:.:.:.:...:....|..
  Rat    28 SPLGKLQALPFGSGAPQGAQGSSASAGDSSLGEPSG-AMKIPNRDSGIESPSSSVASENFPCEEG 91

  Fly  1486 SLFSNEP-LYQMYSAAKLES-ITRDLEAHGSSDGYEEIGLQAKAKPEPLVKPRPTALQLVEPKNG 1548
            |..|..| :..::....::| ..:|....|...|..|       .|:|.:.|       ..|:..
  Rat    92 SEGSPSPAILGLHPEVAVDSRAPQDNPQEGEDSGVGE-------DPDPKITP-------CRPEED 142

  Fly  1549 PSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMNHNAFLDSSVL 1613
            ...|..|:..:::|                ...|::.:|.:|:|.|:||.:.|.   |.|..:.:
  Rat   143 VGSTQCSDPQKLLH----------------IAQELLHTEEAYVKRLHLLDQVFC---AKLTEAGI 188

  Fly  1614 SAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYE----------IAERHFHVYV 1668
            ..:....:||.|..::.            :....:|.||.:.|.|          |.::......
  Rat   189 PPEVTTGIFSNISSIYR------------FHGQFLLPGLKKRITEEWDTKPRLGDILQKLAPFLK 241

  Fly  1669 AFCEHQGRMDRTLRRLKE-SKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAV 1732
            .:.|:....||.:..:.. ::.|..|:..:..::....|..|.|...::.|:||:.|..||:.. 
  Rat   242 MYGEYVKNFDRAMGLVSTWTQRSPQFKDVIHTIQKQEVCGNLTLQHHMLEPVQRVPRYELLLKD- 305

  Fly  1733 FSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEFPSHVRALAIAPVGV 1797
            :.|..|.:..:.:..:.:|.|:.......|.|..:.|:..:|..:..||.....:    :.|...
  Rat   306 YLKRLPRDAPDRKDAERSLELISIAADHSNAAIRKMEKMHKLLEVYEQLGGEEDI----VNPANE 366

  Fly  1798 PRAGAKPRFLVKRGELTHLLWRGEDAKLTFGKRLTKISIYAFLFSDLLLLC----KRRGESCFSV 1858
                     |:|.|.:..|          ..|..|....:.|||::::|.|    :..|:. |||
  Rat   367 ---------LIKEGNIQKL----------SAKNGTTQDRHLFLFNNVMLYCVPKLRLMGQK-FSV 411

  Fly  1859 FDYCPRSMLTLAAGDSLPQLPTKD-LKDQAGKNLILMTLLENCDRKTVELVLSCPSVSDQQRWLQ 1922
                 |..:.::      .|..:| :|..|.:..|:      ..||. .|.|...:..:::.|:|
  Rat   412 -----REKMDIS------DLQVQDVVKPNAARTFII------TGRKR-SLELQTRTEEEKKEWIQ 458

  Fly  1923 AMRPPEAETPGEKLYESWDCPQVVAKHSYESD-----------------EPDVLQLELGDVVNVS 1970
            .::                  ..|.||..:|:                 .||...|..|.|.   
  Rat   459 VIQ------------------ATVEKHKQKSETFRAFSGACTQEEEPSLSPDQPVLSAGPVE--- 502

  Fly  1971 RKLPDGWYQGERIRDGAVGWFPGSYTEELNSAHVRARNLKQR 2012
               |.|      :.|.: |..||..:.:|:|   :.|..|::
  Rat   503 ---PAG------VADSS-GGTPGIESRKLSS---KTRRDKEK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 37/192 (19%)
PH_ephexin 1805..1931 CDD:269929 27/130 (21%)
SH3_ephexin1_like 1944..1998 CDD:212727 15/70 (21%)
Fgd3XP_008769765.1 RhoGEF 157..336 CDD:279015 37/194 (19%)
PH-like 367..474 CDD:302622 31/153 (20%)
PH 367..465 CDD:278594 27/144 (19%)
FYVE_FGD3 527..580 CDD:277279 1/5 (20%)
PH2_FGD1-4 606..710 CDD:270056
PH 622..711 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.