DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and Fgd2

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:XP_038954639.1 Gene:Fgd2 / 309653 RGDID:1309840 Length:707 Species:Rattus norvegicus


Alignment Length:595 Identity:122/595 - (20%)
Similarity:204/595 - (34%) Gaps:155/595 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1415 VFKQATNGAVSPRGDEPVTPTPSGHGGVSSWYAESGLYQTSGI-----------SVASSSGSSGV 1468
            ||:.:.....|  |.|.:.|...| ..:.|:|:..|.....|:           ...|:.||.|.
  Rat    17 VFENSRASFTS--GVEQLDPASPG-AWLDSFYSAPGTALGHGLPWTTTPDVGDHHTQSAGGSPGA 78

  Fly  1469 STGNEAGLGDELSSEPHSLFSNEPLYQMYSAAKLESITRDLEAHGSSDGYEEIGLQAKAKPEPLV 1533
            :.|            ||| |.::|                   |....       |....|||..
  Rat    79 APG------------PHS-FEDQP-------------------HSPEH-------QLPLSPEPWE 104

  Fly  1534 KP----------RPTA-LQLVEPKNGPSRTLWSEIPEVIHSC---ILPTLTSRERSLQEAKFEII 1584
            .|          ||.: ..|...||..|...|.:      ||   ..|...::|...:....|::
  Rat   105 APPAGEALTSEFRPVSRTYLNSLKNKLSSGAWRK------SCQPGASPGPETQEPEEKRVVQELL 163

  Fly  1585 TSEASYLKSLNLLRRHFMNH--------NAFLDSSVLSAKDRKALFSYIVPVHEC-SERLLTELE 1640
            .:|.:|:..|:||.:.|...        .||.:..|      |.:||.|..::.. ::..|.||:
  Rat   164 ETEQAYVARLHLLDQVFFQELLREASRSKAFPEDVV------KLIFSNISSIYRFHAQFFLPELQ 222

  Fly  1641 ACWQDNIMLLGLSRCIYEIAE--RHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEAS 1703
            ....|......:...|.::|.  :.:..||...|....:..|.     ..:|..||:.:.|::.|
  Rat   223 RRVDDWTATPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATW-----MDKSQPFQEVVTRIQRS 282

  Fly  1704 PSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRW 1768
            .:...|.|...::.|:|||.|..||:.. :.::.|....:.|..:..|.::.......|.|....
  Rat   283 EASGSLTLQHHMLEPVQRIPRYELLLKE-YVQKLPAQAPDLEDAQRALDMIFSAAQHSNAAIAEM 346

  Fly  1769 EQAFELERIARQLEFPSHVRALAIAPVGVPRAGAKPRFLVKRGELTHLLWRGEDAKLTFGKRLTK 1833
            |:...|..:.::|.....:    :.|...                  ||..|...|::| :|...
  Rat   347 ERLQGLWDVYQRLGLEDDI----VDPSNT------------------LLREGPVLKISF-RRSDP 388

  Fly  1834 ISIYAFLFSDLLLLCKRRGESCFSVFDYCPRSMLTLAAGDSLPQLPTKDLKDQAGKNLILMT--- 1895
            :..|..||:::||              ||...:|.:.|     |...:...|.||..:..:|   
  Rat   389 MERYLVLFNNMLL--------------YCVPRVLQVGA-----QFQVRTRIDVAGMKVRELTDAE 434

  Fly  1896 ----LLENCDRKTVELVLSCPSVSDQQRWLQAMRP--PEAETPGEKLYESWDCPQVVAKHSYESD 1954
                .|.:..::|:|  |...|..:...|:||.:.  .:.|...|....:...||      .::.
  Rat   435 FPHSFLVSGKQRTLE--LQARSREEMVSWIQACQAAIDQVEKRSETFKAAVQGPQ------GDTQ 491

  Fly  1955 EPDVLQLELG 1964
            ||.....|||
  Rat   492 EPKPQAEELG 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 41/192 (21%)
PH_ephexin 1805..1931 CDD:269929 28/134 (21%)
SH3_ephexin1_like 1944..1998 CDD:212727 6/21 (29%)
Fgd2XP_038954639.1 RhoGEF 156..340 CDD:238091 41/195 (21%)
PH1_FGD2 372..479 CDD:275421 30/128 (23%)
FYVE_FGD1_2_4 505..569 CDD:277280
PH2_FGD1-4 591..692 CDD:270056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.