DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exn and Arhgef3

DIOPT Version :9

Sequence 1:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:XP_006252636.1 Gene:Arhgef3 / 290541 RGDID:1310672 Length:551 Species:Rattus norvegicus


Alignment Length:558 Identity:117/558 - (20%)
Similarity:207/558 - (37%) Gaps:160/558 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1482 SEPHSLFSN---EPLYQMYSAAK---------LESITRDLEAHGSSDGYEEIGLQAKAKPEPLVK 1534
            |||    ||   :||.::.|.|.         |:..::.|:        ..|..:.:::|: ::.
  Rat    58 SEP----SNKRVKPLSRVTSLANLIPPVKTTPLKRFSQTLQ--------RSISFRNESRPD-ILA 109

  Fly  1535 PRPTALQLVEPKNGPSRT-------LWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLK 1592
            ||..:      :|..|.:       ||||..:|   |:...||::|...|||.||:...|...::
  Rat   110 PRAWS------RNATSSSTKRRDSKLWSETFDV---CVSQVLTAKEIKRQEAIFELSQGEEDLIE 165

  Fly  1593 SLNLLRRHFMNHNAFLDSSVLSAKDRKALF---SYIVPVHECSERLLTELEACWQDN-------I 1647
            .|.|.::.:  |:..|..|:::.::...:|   ..::|:|   |.||::|....:.:       .
  Rat   166 DLKLAKKAY--HDPMLKLSIMTEQELNQIFGTLDSLIPLH---EDLLSQLRDVRKPDGSTEHVGP 225

  Fly  1648 MLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLH 1712
            :|:|...|:..        |.::|.:|......   |...|:....|..|:|...||....|:|.
  Rat   226 ILVGWLPCLSS--------YDSYCSNQVAAKAL---LDHKKQDHRVQDFLQRCLESPFSRKLDLW 279

  Fly  1713 SFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERI 1777
            :||.:|..|:.:.|||:..:. :.:|.:..:.:..:..:.::|.:|.:.|......|..:..||:
  Rat   280 NFLDIPRSRLVKYPLLLREIL-RHTPNDNPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERL 343

  Fly  1778 ARQLEFPSHVRALAIAPVGVPRAGAK------PRFLVKRGELTHLLWRGEDAKLTFGKRLTKISI 1836
            ....|                  |.|      .|.|...|||               |....:.:
  Rat   344 LYLEE------------------GQKDSLIDSSRVLCCHGEL---------------KNNRGVKL 375

  Fly  1837 YAFLFSDLLLLCK---RRGESCFSVF-DYCPRSMLTL--------AAGDSL-------------- 1875
            :.|||.::|::.:   ...:.|:.:: ...|...|||        ..|.||              
  Rat   376 HVFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLTLEDLQDGEVRLGGSLRGAFSNNERIKNFF 440

  Fly  1876 -------PQLPTKDLK--DQAGKNLILMTLLENCDRKTVELVLSC---PSVSDQQRWLQAMRPPE 1928
                   .|..|..|:  |...|...|     ||.|:..|.|||.   ..:.|.:...|:.....
  Rat   441 RVSFKNGSQSQTHSLQANDTFNKQQWL-----NCIRQAKETVLSAAGQAGLLDSESLSQSPGTEN 500

  Fly  1929 AETPGEKLYESWDCPQVVAKHSYESDEPDVLQLELGDV 1966
            .|..||...|..|          :||......::..:|
  Rat   501 RELRGETKLEQMD----------QSDSESDCSMDTSEV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 40/191 (21%)
PH_ephexin 1805..1931 CDD:269929 33/163 (20%)
SH3_ephexin1_like 1944..1998 CDD:212727 3/23 (13%)
Arhgef3XP_006252636.1 RhoGEF 152..328 CDD:279015 41/192 (21%)
PH_RhoGEF3_XPLN 342..474 CDD:269976 31/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.