DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LIPC and CG6295

DIOPT Version :9

Sequence 1:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:297 Identity:89/297 - (29%)
Similarity:132/297 - (44%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    55 KTLHEMKTR-------FLLFGETNQGCQIRINHPDTLQECG-------FNSSLPLVMIIHGWSVD 105
            :|.:.|:.|       |.|:..:|:      |.|..::...       ||.:.|....|||||..
  Fly    50 ETKNRMEGRNVLNPVTFYLYTNSNR------NSPQEIKATSASISGSHFNPNHPTRFTIHGWSSS 108

Human   106 -------GVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRWL 163
                   ||.:.|...          ..:|:..|||.......|..:|.....||::||.|:.::
  Fly   109 KDEFINYGVRDAWFTH----------GDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFM 163

Human   164 EESVQLSRSHVHLIGYSLGAHVSGFAGSSI--GGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDA 226
            ..:..|:..:..:||:||||||||:||.::  |..|   .|.|||.|.|||...:|:.|||..||
  Fly   164 RSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLH---TIIGLDPALPLFSYDSPNKRLSSTDA 225

Human   227 NFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSH 291
            .:|::|.|     .|.::|..:|||...||||||..||||               .:..|..|:|
  Fly   226 YYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKSQPGC---------------GVDLTGSCAH 270

Human   292 ERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSC 328
            .|||..:.:|:......:|.  |||   :.:.:...|
  Fly   271 SRSVIYYAESVTENNFPTMR--CGD---YEEAVAKEC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LIPCXP_005254431.2 None
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 86/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.