DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOH and Rac1

DIOPT Version :9

Sequence 1:NP_001265288.1 Gene:RHOH / 399 HGNCID:686 Length:191 Species:Homo sapiens
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:177 Identity:74/177 - (41%)
Similarity:117/177 - (66%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     2 LSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFR 66
            :.:||||:|||.|||||.||:.:|:..||..|.|||::|...:|.:|...|:||||||||.:.:.
  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65

Human    67 SIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQRE-------MG 124
            .:|||||.|.||.|:|:|:.|..||.|::.||..|:|.:.|.||:::|.|:.|.|:       :.
  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130

Human   125 PHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAV 171
            ..:.:.:...:|..:|:::.|..|||||||:.:|::.||:.|:|:.:
  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHOHNP_001265288.1 Rho 5..169 CDD:206641 73/170 (43%)
Effector region. /evidence=ECO:0000250 33..41 4/7 (57%)
Interaction with ZAP70. /evidence=ECO:0000250 73..86 7/12 (58%)
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 74/172 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.