powered by:
Protein Alignment Cpr73D and Cpr65Ax1
DIOPT Version :9
Sequence 1: | NP_001097627.1 |
Gene: | Cpr73D / 39897 |
FlyBaseID: | FBgn0036680 |
Length: | 597 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097523.1 |
Gene: | Cpr65Ax1 / 5740751 |
FlyBaseID: | FBgn0086900 |
Length: | 102 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 21/69 - (30%) |
Similarity: | 36/69 - (52%) |
Gaps: | 11/69 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 SYSFSFRTPD-QSRSEE---NDSGNRI-----RGLYSYLDDVGERHSVRYAAGAGTGFEISNA-V 180
:||::..|.| .|:||| .::|..: .|.:||:...|:.::|.|.|.. .||:...| :
Fly 33 NYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADE-NGFQPQGAHL 96
Fly 181 PDSP 184
|.:|
Fly 97 PVAP 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.