DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Cpr100A

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:259 Identity:60/259 - (23%)
Similarity:87/259 - (33%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLLLLCAVLGYFSDPARAEI--EYNTISEDGSFQFRHANDDIGGYYHSASGTPDNTVRGRYGSRS 72
            :|:.|.:...|..||..|.|  |...:|.||.|...:..:|  |.........|.|..|.|....
  Fly     9 TLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQED--GINFKEETDADGTRHGSYSYLD 71

  Fly    73 PASGQIEETVYTAGPRGFRVNGPKIHRKMDLAQYPVLPRG-------------SP-DDPLA---- 119
            | :||.....||||..||:.:|..:.:.......||...|             :| ..|.|    
  Fly    72 P-TGQRRTISYTAGKNGFQASGDHLPQAPPAPPQPVPTAGYQPQQQYQPQQYQAPAPQPQASFRS 135

  Fly   120 -DPFDDPSYSFSFRTPDQSRSEENDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFEISNAVPDS 183
             |..||.||...:..|...::::           ||.....:   .:|.......:......|..
  Fly   136 NDYGDDGSYDPRYNDPSFGQNQQ-----------SYQQPAAQ---PQYRPAPQPAYNPQPVQPQQ 186

  Fly   184 PSVVAYSSPLYTSHPKARGKMSVQRGPAGSYKLIASGSDHRRAE------SRAPDGLVRGTYSF 241
            .....|..|    .|:.:     |..|..:|....:.:.||.:.      :|.|||.   ||||
  Fly   187 QYQPQYQQP----QPQYQ-----QPQPQQAYYTTTTPNPHRFSPPGKLSLNRTPDGF---TYSF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 5/46 (11%)
Chitin_bind_4 <223..257 CDD:278791 10/25 (40%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.