DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:392 Identity:84/392 - (21%)
Similarity:120/392 - (30%) Gaps:136/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GFRVNGPKIHRKMDLAQYPV-LPRGSP------------DDPLADPF----------DDPSYSFS 130
            |..:.|..:.|..|...|.. .||.:|            :.|.|||.          :|.||::.
  Fly    11 GCLIVGVGMVRSQDYQDYQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNEDGSYTYG 75

  Fly   131 FRTPDQS-RSEENDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFE-----ISNAVP-------- 181
            :...|.| :.|...:...::|.|.|:|:.|:...|.|.|.. .||:     |:.|.|        
  Fly    76 YEGADGSFKIETKLATGEVKGKYGYVDETGKVRVVEYGANK-YGFQPSGEGITVAPPTLVDETLK 139

  Fly   182 ------DSPSVVAYSSPLYTSHPKARGKMSVQRGPAGSYKLIASGSDHRRAESRAPDGLVRGTYS 240
                  |.|:......|.....|:.|.:...|..|...|.       ....|..:|         
  Fly   140 EEPDYADEPAPQRPQKPYRVQRPQPRPQPRPQPQPQPQYV-------QYEVEEESP--------- 188

  Fly   241 FLDDKGVQRTVEYI-AGAGIGYRVVQNRIGPGTHNNPSVADF----------RLTD--------- 285
                    |.|:|. |.......:.|.:..|..|:.|||...          |.||         
  Fly   189 --------RRVQYAPAPQPQPQPLPQPQHLPQQHHQPSVGPAPPRLQVPGAQRTTDVLYSPLQRP 245

  Fly   286 ----PDFRLANDFGRG------------------------AGGGLGPKGGGGGSGGGSVSVGASG 322
                ||:.....||.|                        |.|.|.|..||             .
  Fly   246 ARPEPDYSQTQSFGDGPSNVRISRPVYALPPASPAPSSARAQGFLAPASGG-------------R 297

  Fly   323 PSGGAGGAGRGRTPS-RP-GGKDYLKPADGARDRNRGDGDAGAADENLGHHADDQGD-----DIG 380
            |.....|.|:.:.|| || ..:...:|....:.|:.|.|.:|..|:....:|..||:     ||.
  Fly   298 PLLEPVGFGQSQGPSARPVQQQPSFQPQPRPQARSGGGGGSGLLDQLARDYALPQGNAQPLHDIT 362

  Fly   381 LG 382
            .|
  Fly   363 FG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 12/47 (26%)
Chitin_bind_4 <223..257 CDD:278791 6/34 (18%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.