DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Edg78E

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:85 Identity:21/85 - (24%)
Similarity:38/85 - (44%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SYSFSFRTPDQSRSEENDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFEISNAVPDSPSVVAY- 189
            :|.:::.|.:..:.:|..:.|..||..:|:...||..|:.|.|.......:.:.:|..|.|.|| 
  Fly    38 NYQYAYETSNGIQIQEAGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYV 102

  Fly   190 --SSPLYTSHPKARGKMSVQ 207
              :.....:||.|..:...|
  Fly   103 LRALEYIRTHPPAPAQKEQQ 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 12/46 (26%)
Chitin_bind_4 <223..257 CDD:278791
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.