DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Cpr67Fa1

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:40/93 - (43%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GSPDDPLADPFDDPSYSFSFRTPDQSRSEEND-SGNRIRGLYSYLDDVGERHSVRYAAGAGTGFE 175
            ||...|      :.:|::.:.|.:...::|:. .||...|.:|:....||...:.|.|.. .|::
  Fly    33 GSDIQP------EGNYNYQYETSNGIAAQESGIGGNHANGGFSWYSPEGELVQISYVADE-NGYQ 90

  Fly   176 ISNAV----PDSPSVVAYSSPLYTSHPK 199
            ...|:    |..|:.:..|.....:||:
  Fly    91 PQGALLPTPPPIPAAILRSLEYIRTHPQ 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 11/47 (23%)
Chitin_bind_4 <223..257 CDD:278791
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.