powered by:
Protein Alignment Cpr73D and Cpr49Ag
DIOPT Version :9
Sequence 1: | NP_001097627.1 |
Gene: | Cpr73D / 39897 |
FlyBaseID: | FBgn0036680 |
Length: | 597 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610776.1 |
Gene: | Cpr49Ag / 36353 |
FlyBaseID: | FBgn0033730 |
Length: | 134 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 20/75 - (26%) |
Similarity: | 27/75 - (36%) |
Gaps: | 24/75 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 DPSYSFSFRTPDQSRSE-------------ENDSGNRI----------RGLYSYLDDVGERHSVR 165
|.|::.|:.|.:..|.| |...|..| .|.|||.|..|...::|
Fly 50 DGSFNSSYETSNGIRVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLR 114
Fly 166 YAAGAGTGFE 175
|.|.. .||:
Fly 115 YVADE-NGFQ 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.