DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:288 Identity:56/288 - (19%)
Similarity:93/288 - (32%) Gaps:115/288 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ASGTPDNTVRGRYGSRSPASGQIEETVYTAGPRGFRVNGPKIHRKMDLAQYPVLPRGSPDDPLAD 120
            ||..|||  .|:|                                       .:|:.|.:|....
  Fly    21 ASPVPDN--NGKY---------------------------------------TVPQQSSNDGKYR 44

  Fly   121 PFDDPSYSFSFRTPDQSRSEENDSGNRIRGL---YSYLDD---VGERHSVRYAAGAGTGFEISNA 179
            |.||..|..:  :.::.||...:|..|...:   |.::.|   :|:.|.:.|....|.|....:.
  Fly    45 PSDDGKYHGN--SQNEGRSGSQESIGRYHHMPIPYRHVSDQRELGKYHHIPYPYDGGYGPYAGSN 107

  Fly   180 VP----DSPSVVAYSSPLYTSHPKARGKMSVQR-------------------GPAGSYKLIASGS 221
            :|    |.|    |:..||||....:...:.:|                   ...|.:|::    
  Fly   108 IPYVHDDRP----YNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKIL---- 164

  Fly   222 DHRRAESRAPDGLVRGTYSFLDDKGVQRTVEYIAGAGIGYRVVQNRI--GPGTHNNPSVADFRLT 284
              .:.|.|..|   :..:|:|.:.|:             |...|.::  ..|||   :...:..|
  Fly   165 --HKEEVRKQD---KYDHSYLTENGI-------------YGEEQAKLHHTGGTH---AKGFYEYT 208

  Fly   285 DPDFRL------ANDFGRGAGGGLGPKG 306
            ..|.:|      :||      ||..|:|
  Fly   209 GDDGKLYRVNYASND------GGFMPQG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 11/52 (21%)
Chitin_bind_4 <223..257 CDD:278791 6/33 (18%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.