DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and AgaP_AGAP010109

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_554005.2 Gene:AgaP_AGAP010109 / 3292125 VectorBaseID:AGAP010109 Length:140 Species:Anopheles gambiae


Alignment Length:83 Identity:27/83 - (32%)
Similarity:35/83 - (42%) Gaps:11/83 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SYSFSF-----RTPDQSRSEENDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGF------EISNA 179
            :|.||:     .|.|.....|...|::::|.||.||..|.|..|.|.|....||      |.:|.
Mosquito    57 NYEFSYSVHDSHTGDVKSQHETRHGDQVQGQYSLLDADGHRRIVDYTADDHNGFNAVVRREPANV 121

  Fly   180 VPDSPSVVAYSSPLYTSH 197
            ....|.....:.||||.|
Mosquito   122 KVAQPVQKVIAQPLYTGH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 17/51 (33%)
Chitin_bind_4 <223..257 CDD:278791
AgaP_AGAP010109XP_554005.2 Chitin_bind_4 58..110 CDD:278791 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.