DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and Cpr11A

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:281 Identity:63/281 - (22%)
Similarity:90/281 - (32%) Gaps:81/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RKMDLAQYP-----VLPRGSPDDPLADPFD--------------DPSYSFSFRTPDQSRSEENDS 144
            |.:||.:|.     .||....||..|..|.              :....|......|:..|.:..
  Fly    24 RNLDLFKYNPSDIYTLPEDIDDDKPAVHFSGDVMKAKTETLQNYNSGKKFKLELKTQNGIEVSSV 88

  Fly   145 GNR-------IRGLYSYLDDVGERHSVRYAA---GAGTGFEISNAVPDSPSVVAYSSPLYTSHPK 199
            |..       :.|.||:....|:|:..||.|   |.....|:...:|: |..:|.:....|..|.
  Fly    89 GKLKDDKTFVVSGSYSFTGADGKRYKTRYTADEFGYHPITELDLDIPE-PQPLASAGQRQTVDPS 152

  Fly   200 ARGKMSVQRGPAGSYKLIASGSDHRRAESRAPDGLVRGTYSFLDDKGVQRTVEYIAGAGIGYRVV 264
            :                 ..|:.:|              :.||     |:|::...|:.      
  Fly   153 S-----------------LLGNKNR--------------FQFL-----QQTLDSDQGSQ------ 175

  Fly   265 QNRIGPGTHNNPSVADFRLTDPDFRLANDFGRGAGGGLG---PKGGGGGSGGGSVSVGASGPSGG 326
                ||...:..|..|:..|.| :...|.:|.|.|.|.|   ..|.|.|.|.|..: ||....|.
  Fly   176 ----GPLRGSGQSGDDYSYTSP-YGNGNAYGNGVGNGYGNGVGNGYGNGVGNGQGN-GAGNAYGN 234

  Fly   327 AGGAGRGRTPSRPGGKDYLKP 347
            ..|.|.|.......|.||..|
  Fly   235 GNGVGNGYGNGNGNGYDYQPP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 13/56 (23%)
Chitin_bind_4 <223..257 CDD:278791 5/33 (15%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:278791 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.