DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and CPR100

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_319275.3 Gene:CPR100 / 1279543 VectorBaseID:AGAP010128 Length:231 Species:Anopheles gambiae


Alignment Length:148 Identity:37/148 - (25%)
Similarity:58/148 - (39%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YHSASGTPDNTVRGRYGSRSPASGQIEETVYTAGPRGFRVNGPKIHRKMDLAQYPVLPRGSPDDP 117
            :|.:..|..:|::..........|.:.     |.|..::.:.|.|.:  .:||..::.......|
Mosquito    24 HHGSIATSHSTIQHHAAPTIQHVGSVH-----AAPAIYQHSAPAIVK--TIAQPTIIKSVEHHAP 81

  Fly   118 LADPFDDPSYSFSF-----RTPDQSRSEENDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFEIS 177
                   .:|.||:     .|.|.....|...|:.:.|.||.||..|.:..|.|.|...|||   
Mosquito    82 -------ANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF--- 136

  Fly   178 NA-VPDSPSVVAYSSPLY 194
            || |...||.|..:.|::
Mosquito   137 NAVVRREPSAVKIAQPVH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 17/51 (33%)
Chitin_bind_4 <223..257 CDD:278791
CPR100XP_319275.3 Chitin_bind_4 84..136 CDD:278791 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.