DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpr73D and CPR106

DIOPT Version :9

Sequence 1:	NP_001097627.1	Gene:	Cpr73D / 39897	FlyBaseID:	FBgn0036680	Length:	597	Species:	Drosophila melanogaster
Sequence 2:	XP_316152.4	Gene:	CPR106 / 1276767	VectorBaseID:	AGAP006095	Length:	150	Species:	Anopheles gambiae

Alignment Length:	83	Identity:	24/83 - (28%)
Similarity:	39/83 - (46%)	Gaps:	9/83 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   110 PRGSPDDPLADPFDDP------SYSFSFRTPDQSRSEE-NDSGNRIRGLYSYLDDVGERHSVRYA 167
            |:|.||........|.      ||::::.|.:..::.: :|:|....|.||:|...|..:||.|.
Mosquito    29 PQGGPDSEATVVAQDQIINEGGSYAYNYETSNGIKARQTSDNGVSANGEYSFLAPDGTSYSVVYV 93

  Fly   168 AGAGTGFEISNA-VPDSP 184
            |.. .||:...| :|..|
Mosquito    94 ADE-NGFQPQGAHLPTEP 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpr73D	NP_001097627.1	Chitin_bind_4	127..174	CDD:278791	13/47 (28%)
Cpr73D	NP_001097627.1	Chitin_bind_4	<223..257	CDD:278791
CPR106	XP_316152.4	Chitin_bind_4	52..99	CDD:278791	13/47 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910