DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and CPR9

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_003436223.1 Gene:CPR9 / 1273241 VectorBaseID:AGAP002726 Length:225 Species:Anopheles gambiae


Alignment Length:158 Identity:35/158 - (22%)
Similarity:68/158 - (43%) Gaps:22/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AGPRGFRVNGPK--IHRKMDLAQYPVLPRGSPDDPLADPFDDPSYSFSF---RTP---DQSRSEE 141
            ||.|....:.|:  :..:.:..|...||  .|..|         |:|::   |:|   |::.||.
Mosquito    17 AGRRDVTRHKPQLVVVEEYEERQTTTLP--PPPKP---------YAFTYSAGRSPGHVDRTHSEV 70

  Fly   142 NDSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFEISNAVPDSPSVVAYSSPLYTSHPKARGKMSV 206
            :|....:||.:||:|...:..:|.|.|.:...:.:.:.:|.:|......:.....|.....|::.
Mosquito    71 SDGSGVVRGSFSYVDPRNQVRTVEYTADSHGFYPVLSHLPATPQQTEAVARAQEKHFALYAKIAQ 135

  Fly   207 QRGPAGSYKLIASGSDHRR---AESRAP 231
            :...|.|.:.:.|.:...|   |:::.|
Mosquito   136 EHADAHSGRAVVSFAVRNRLLQADAKTP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791 16/52 (31%)
Chitin_bind_4 <223..257 CDD:278791 3/12 (25%)
CPR9XP_003436223.1 Chitin_bind_4 50..102 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.