DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr73D and CPR111

DIOPT Version :9

Sequence 1:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_308831.4 Gene:CPR111 / 1270156 VectorBaseID:AGAP006931 Length:325 Species:Anopheles gambiae


Alignment Length:129 Identity:39/129 - (30%)
Similarity:56/129 - (43%) Gaps:25/129 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ISNAVPDSPSVVAYS--SPLY-TSHPKARGKMSVQRGPA------------GSYKLIASGSDHRR 225
            ::.|.|.:....||:  ..|| .:.|.|........|||            |.|....:|....:
Mosquito    13 VATAAPSATLYAAYAHQPALYAAAAPLAPATYIAAAGPAELHSQYHAQDELGQYSYGYNGGLSAK 77

  Fly   226 AESRAPDGLVRGTYSFLDDKGVQRTVEYIAGAGIGYRV---------VQNRIGP-GTHNNPSVA 279
            |||::.||:.||:||:||.:...:||.|.|.|..|:||         |:.|..| ...:.|.||
Mosquito    78 AESKSFDGITRGSYSYLDAENKLQTVAYTADALNGFRVAASNLPVAPVETRTAPEPVQDTPEVA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:278791
Chitin_bind_4 <223..257 CDD:278791 15/33 (45%)
CPR111XP_308831.4 Chitin_bind_4 66..113 CDD:278791 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.